PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013968.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 297aa    MW: 33522.3 Da    PI: 7.7335
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013968.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.85.7e-141562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l +++ ++G  +W++++ +  + R +k+c++rw +yl
      Pbr013968.1 15 KGLWSPEEDLRLRNYILKHGHSCWSSVPIKADLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding54.13.6e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E+e ++ ++++lG++ W+ Ia++++ gRt++++k++w++yl
      Pbr013968.1  68 RGTFSKHEEETILTLHHMLGNK-WSQIAQHLP-GRTDNEIKNYWHSYL 113
                      899*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.081062IPR017930Myb domain
SuperFamilySSF466893.0E-2713109IPR009057Homeodomain-like
SMARTSM007174.6E-91464IPR001005SANT/Myb domain
PfamPF002493.2E-121562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-201669IPR009057Homeodomain-like
CDDcd001674.75E-81862No hitNo description
PROSITE profilePS5129425.68163117IPR017930Myb domain
SMARTSM007172.8E-1667115IPR001005SANT/Myb domain
PfamPF002499.6E-1668113IPR001005SANT/Myb domain
CDDcd001672.36E-1170113No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGCKPSDKPK AKHRKGLWSP EEDLRLRNYI LKHGHSCWSS VPIKADLQRN GKSCRLRWIN  60
YLRPGLKRGT FSKHEEETIL TLHHMLGNKW SQIAQHLPGR TDNEIKNYWH SYLKKKVAKA  120
EETMEGQRKS QYTSTSSSEI LECSPSPQKS TTGINPSYES VQKSPPFNDL SKDQSCHLSP  180
LPKIMFAEWL SLDHVHGGSF ANNISDTGVS REGFDHSTTS NNLQADHDLG HGFELNNEGT  240
FGSGFHHGIS HHHGSGSEMI NSQYKFEEQI SGPGFADFVD LCSDFNLQND AMYFYK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22151177108B-MYB
1h8a_C2e-221511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009371324.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K44e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLM5XTG91e-166M5XTG9_PRUPE; Uncharacterized protein
STRINGGLYMA16G31280.13e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.12e-63myb domain protein 19